SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72383749|ref|YP_293103.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72383749|ref|YP_293103.1|
Domain Number 1 Region: 116-250
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-24
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 29-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.4e-20
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72383749|ref|YP_293103.1|
Sequence length 288
Comment GntR family transcriptional regulator [Ralstonia eutropha JMP134]
Sequence
MWSITVQSTTENLAQAEQLPTGKSGFEPTLADRVTEHLAGQIRRGMYPVNARLPTEKFMT
EQFGVSRTVIREAISRLKSEGLVESRQGSGTVVLNPATAEVFRLGRGGSDPALGVVRILE
LRRGIEAEMAALAAERRSERQMDDIRSALHEIDSAVRAGGDGVEEDLAFHLAVSRATGNP
HYTELLGMLTRALRDAIRLTRGNEARRSDLAAHVRTEHAEICAAIETQDPQRARQAAFLH
MRNTEERILAAERDFWTGDSRTAAQRLAGADLSTVMRRAAEGGRTDAE
Download sequence
Identical sequences Q46NK8
gi|72383749|ref|YP_293103.1| gi|72383749|ref|YP_293103.1|NC_007336 264198.Reut_C5903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]