SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73540313|ref|YP_294833.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73540313|ref|YP_294833.1|
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.37e-47
Family Methylesterase CheB, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73540313|ref|YP_294833.1|
Sequence length 328
Comment chemotaxis protein CheB [Ralstonia eutropha JMP134]
Sequence
MTRNVVTIGGSRGAFTVLRDVVAALPAALDAAVFIVLHVGKHKSELPSLLTRWGKLPASY
PQHGDVWKPGHIYVAPPDHHMLITADTIHLSHAAKENFSRPAIDPLLRSAAVALGSRVIG
VILSGDLDDGAAGLAFVRAFGGRTLIQNPRDAEATSMPKSAMEAAGADLMASPAELGHAI
VALLQASGEGEFDPKREKDMQALRSEAATADNPAGSAFEELDSIAARAAITCPECGGAMW
QLRDTHPLRFRCHTGHAFSGMTLTAAEDKATEHAMWTAVRAQKEALALARIRAAHAKSDG
NRDAYQIELSRIQQCERLLKVLQGAIAE
Download sequence
Identical sequences Q475E4
gi|73540313|ref|YP_294833.1| WP_011296795.1.84135 264198.Reut_A0607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]