SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.30063 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.30063
Domain Number 1 Region: 18-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-43
Family Glutathione peroxidase-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.30063
Sequence length 200
Comment glutathione peroxidase
Sequence
MGNFLASTKITTDLASKSVYSYTLTTLEGNLFPMESLKGKVVMVTNVASKCGYTKSYYKQ
MVRIYSVFAPLGLEIIGLPSREFMGQEFEDPKEIRKFADSHNVKFPLMEICKVNGPDALE
FVQKLKRETPELYDEKSNTLSAIKWNFSRFLIDKNGKVVAFRGTRTEPNELIPKIAELLG
VSDYQNLFKNYDKLHPEVRL
Download sequence
Identical sequences Chro.30063 gi|67624029|ref|XP_668297.1| 237895.Q5CN83 XP_668297.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]