SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.30107 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.30107
Domain Number 1 Region: 89-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 1-45
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000188
Family Cold shock DNA-binding domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Chro.30107
Sequence length 174
Comment hypothetical protein
Sequence
MAFEGATKRNKPNLVPGNYVCSRINYVDLESGEIELTCITPEEKKTWSNNENYLGVLKNS
NYKNTNIIEDYSKSDRSSLPGESQSCIKDGMTVTVPQSVAQILLADQSYVLEALSKYFAY
EICVGQNGIIWFSASNIKEMLLIMSALKVIPNCTKPQVSLNNFLLAGLNDLYLP
Download sequence
Identical sequences XP_665191.1.74355 gi|67586458|ref|XP_665191.1| 237895.Q5CEC8 Chro.30107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]