SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.30334 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.30334
Domain Number 1 Region: 144-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.13e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Chro.30334
Sequence length 344
Comment hypothetical protein
Sequence
MSVGTPMENQEIISKKRRYRKDKPWDTDDIDHWNVPKLTPEDNPHGLLEESSFAVLFPKY
REKYLRDIWPDIRNALKAHHIKCELDLVEGSITVRTTGKTWDPFIIIRARDMVKLLSRSV
PFHQAVRILGDGEDDNNLGCDIIKIGHRNKEKMVKRRQRLVGPNGSTLKAIELLTNCYVL
VQGQTVSVIGSYKSLKLVRRIVEDCMNNIHPVYHIKELMIKRELEKDERLRGENWDRFLP
KFKNKCVKRKVKKQMKKKNKSIFPPEPTPRKEDMLLETGEYFYSELERKAKQIKERISEQ
KEKKNEKHKEREKIYVPPNEKLFLKNKISNQNEINYKTFGQNLX
Download sequence
Identical sequences Chro.30334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]