SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.60457 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.60457
Domain Number 1 Region: 118-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-25
Family Thioltransferase 0.00023
Further Details:      
 
Weak hits

Sequence:  Chro.60457
Domain Number - Region: 43-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00323
Family Thioltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Chro.60457
Sequence length 219
Comment thioredoxin-like protein
Sequence
MSTTLNSFVGITDFVLGNCLSAILILSGKEEIDGSLLELESVLQESFSNVKFGKISPSGV
NEISAIKQFDVKELPSILLFTCQSLKPYKVISGYNPSELHTNLEELIKIQNLSIPSQNEK
FKILTNFKSLMVFMKGIKEEPYCRFAKGLVSLLDSIKVKNYGHYNIFENEETRQGLKEYH
NWPTFPQICINGEFIGGLDILNEMHSNGELVNEIPKDAF
Download sequence
Identical sequences A0A0S4TH90
Chro.60457 XP_666398.1.74355 237895.Q5CHT3 gi|67601441|ref|XP_666398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]