SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.70085 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.70085
Domain Number 1 Region: 105-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 24-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Chro.70085
Sequence length 364
Comment hypothetical protein
Sequence
MVNSSNMERTNYINIQNEEEQIIFVKLLISDKAANRILSNSGSILKKIKQVNHVFILVSG
ANKYFPGTNYRVATLEGNEKNVNETMEVLDFLLKNNKDDGQEGLKNYEYNIRLAVPRSVI
GSIIGIKGEFISHVRTATNAHINISPIFVTSEKACNERIITISGSNSNQVIHAFIILTKK
VNSSPEGRSCKSVIYRRADFFRRKNHKTEHEKVDPLLSSQLEEMKNVLNENPINSAYEVE
SRSLEIKEKPKLNFKTTSKGRWSEQVDLLAREEDKSLEKLGSELKQVKIIQKGLIEGAQI
NISQKTELANDDNKMQENLAEKLYEAPSKTVQERIPTNLFIISFLALITGAFFLQYISSE
VIRV
Download sequence
Identical sequences A0A0S4TJG2
XP_666123.1.74355 gi|67597106|ref|XP_666123.1| 237895.Q5CH09 Chro.70085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]