SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.70217 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.70217
Domain Number 1 Region: 699-774
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  Chro.70217
Domain Number - Region: 422-488
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 
Domain Number - Region: 619-698
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00868
Family Eukaryotic type KH-domain (KH-domain type I) 0.0073
Further Details:      
 
Domain Number - Region: 281-334
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0234
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Chro.70217
Sequence length 818
Comment KH domain
Sequence
MAKKRPNQGKGTSGKGKQKSPSNGKTNVEQKHKQEEKIEEPQVIEETPAVVDFSGLSATQ
KKNLKRRLKKKSMDSNPQEGQGAGKQRKPLTKKEIEAMLPNDPMSKTRSEFLSKINSNLR
GMLDLSVLPIEEVLSKKGEQERELNRLLSNISETLSKESSNLKKPPKHLSVNTICEQLRD
FELASKDEEGYDEEFYQHLKELLVVASLYENYRNFQNQCNELRTRIERKLSINKELSQAA
ADSNKQKRLVNRVKGLKQDSSIDNDSVETKVFELPNNKGNLLDVLFGSSAKMAKNLEKKF
GALVEKSTGNSVQITGLLKDIESCWESIRQLDFSSQETISLDPRVIKKLYSMTGNINLKS
LQDELSIIINRMENSLTILGSPESTKAAVEIINKNSDISSNTVSISVSLIIAKALQFNFL
PTVRSIEKETETSVRIQFGGKSREVSSLADISDSQHDSKILIFGKPDKCEVAKNKLSNLI
KGLEVESIQADSKAVRKLFSPPGKDSSDDSNARISRSILDEFSKLRDSNKMGIVRIGSSV
VLVGPASEIKKAKPNLLDLLERAQYTPLTKTIHRDQLRVLNHSRREKVEKEACVEISTHK
RQEGRSVVIEVLGSEQAKAKAGTLIDEILTKEAHLETLELDSCTYDKLYGSQRSHLRKLT
SNFPNVQVIQAEKKRNSISLLGSKEEVLKLKEKFLEFNRQTLESSSNETKEIIEIPSGKM
GLIIGTKGSVLNEIRSKANCESINVPKNSSHVVLQGTEEQCTIARNLISEILSNSLSNSN
TTTCSEQSGPHSNKISAPESLKFDEKCFPTLGGTISTF
Download sequence
Identical sequences A0A0S4TID9
gi|67624441|ref|XP_668503.1| 237895.Q5CNS7 Chro.70217 XP_668503.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]