SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.70530 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.70530
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000156
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  Chro.70530
Domain Number - Region: 24-59
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00398
Family Glutathione S-transferase (GST), N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.70530
Sequence length 161
Comment hypothetical protein
Sequence
MIEYLEHNISGKDFLQPEFQQVLVESGNFPMLPYFSDSNNEVELTGSFTILRYLADKCKL
MGKSPEERNKIENWLEYLQSLLHSVWDFENMSDNYTGIQQAKKKSQFLLETLHPMLKCID
EKIEQGVWALESYSVVDIVLYSAISVIIRSWGSDLLKPYIR
Download sequence
Identical sequences A0A0S4TK06
XP_667744.1.74355 gi|67621057|ref|XP_667744.1| Chro.70530 237895.Q5CLN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]