SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.80099 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.80099
Domain Number 1 Region: 78-313
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-60
Family Tandem AAA-ATPase domain 0.0000911
Further Details:      
 
Domain Number 2 Region: 252-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.84e-37
Family Tandem AAA-ATPase domain 0.004
Further Details:      
 
Weak hits

Sequence:  Chro.80099
Domain Number - Region: 705-773
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0645
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.80099
Sequence length 794
Comment ATP-dependent RNA helicase
Sequence
MNPSLSKIEELLSLDKKKRIPEINHEVINYPPIIKNYYKEVNEIKKLKQHEVDHIRITNN
GIHIKKIKNINKTSNDLNQPYSSIKPILNFSQCGLPLPIHHYLKKKNIIKPFPIQMQSIP
ILMSGYDMIGNAETGSGKTLAYILPLIRHVLVQSNNNYPFNADVDIQINKNTNLVRAMII
IPTRELALQVYKQTTQLANLVDLTTNIICGGLSISHQLNKIRSGSDIIIGTPGRIIDIMT
LLHKKIVIFQFISFLVIDEGDRLFDMGFAPQLLSIISIIRPDRQIAIFSATFPNIIEQFT
NKILHNPIQVIVGKKGQMNQNVKQYIELLNNENDQFLRLLQLLGEWAEFGLIVIFCNRQT
DVDELFAKLIPFGYNCLTLHSGQDHYDRHSNLTTFSKTNMNSNPPPPSGQNILIATSIFS
RGLHVDNILLVINFGAPHHIEDYIHRIGRTGRAGNFGTSFTLLLPNEIPQSFDLIELAMK
YSNNNASNRHISRNIHRNDDDNNSNANSNNFVDDDSTIIIQPEIIQLYNELIQKNKSASS
ISNNSSNKRIRNFGFGGKGFKFSKDEKSSLQLLKDDTKKALGLIPDTTNITEEQIFINSN
YDDDTTNNNNNNNTTSDANTLSHSEIAHMPEAEKALQLATINAAKLNNVCNIQNPNIISI
TDYSNPNSITIPNNLHQVVNGRVIGIFEINDYPTLIRQKIVHKDIIKTINENCGVICQVK
GIYIPPDSSNPSTSSVHISEKKKLYIEINGPNHPKVQKAIHEINLIISSVKQQSNVIKPS
FTTGKYTLSNLIKK
Download sequence
Identical sequences Chro.80099 gi|67594781|ref|XP_665880.1| XP_665880.1.74355 237895.Q5CGC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]