SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Chro.30220 from Cryptosporidium hominis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Chro.30220
Domain Number 1 Region: 173-308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 439-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000214
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 3 Region: 306-427
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Chro.30220
Sequence length 569
Comment ENSANGP00000004359
Sequence
MMLLISYIIFIYTWLMLFEKVDGSFLTGNNIAAAITTKQGTKSNTGSILGNANSMDTILM
TAKILSTADTIQKSIQNENKDQRVKASGAEVGQENFTALKGQNSTREDLIGSGIQYCNID
KDGLCCLMPNYCSKEATCKSDIVGQQTYIDYLNALPRCQCLPGYIGDGRTKGTGCQNVNE
CLTGEARCEQLCTDYSPGYACSCNMGYRLNTKDMRSCIDIDECKEGSHSCSHICVNTRGS
FVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCKNLPGGFECQCPSGYKLDKKTQK
CIDIDECKEEKNLCTGFGEVCFNKKGGFECKCGTGFQYDENENACKDINECVLNTHDCKK
DSVCVNEDGGFSCKCLEKGFEFNKEKRACEDIDECSNGDSKCDQLCFNTIGGYRCGCYKG
FRLNLTGPEENRLDVKSRVCIDIDECLESPELTGCSHGCINKRGGFQCTCPKGFQLGMDG
KVCEDIDECRMPENPCENNRQFPCCLNTLGGFTCVEQIMSGDLFKRHECPKADGDSIKRE
PRTGNVNNSSGKFKWFRSNTDTVNRLKTK
Download sequence
Identical sequences A0A0S4TDZ1
Chro.30220 XP_668665.1.74355 gi|67624765|ref|XP_668665.1| 237895.Q5CPB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]