SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000077 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000077
Domain Number 1 Region: 494-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.84e-114
Family PDEase 0.000000274
Further Details:      
 
Domain Number 2 Region: 52-248
Classification Level Classification E-value
Superfamily GAF domain-like 6.32e-38
Family GAF domain 0.00027
Further Details:      
 
Domain Number 3 Region: 235-279,306-455
Classification Level Classification E-value
Superfamily GAF domain-like 7.06e-32
Family GAF domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000077   Gene: ENSRNOG00000000065   Transcript: ENSRNOT00000000077
Sequence length 856
Comment pep:known chromosome:Rnor_5.0:14:2327104:2370811:-1 gene:ENSRNOG00000000065 transcript:ENSRNOT00000000077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQVRSFLDGNPTFAHQYFEKKLSPENVAGACEGGCLVDCGSLRELCQVEESAALF
ELVQDMQESVNMERVVFKVLRRLCTILHADRCSLFMYRQRNGVAELATRLFSVQPDSLLE
DCLVPPDSEIVFPLDIGIVGHVAQTKKMINVQDVAECPHFSPFADELTDYVTKNILSTPI
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFTKYLNFATLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALTSGLPTYVAESGFICNIMNA
SADEMFNFQEGPLDESGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQEILPTRDRLGKEPADC
EEDELGKILKEELPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEEKKKEEDRVAAKKAGTE
ICNGGPAPKSSTCCIL
Download sequence
Identical sequences D3ZDI8
10116.ENSRNOP00000000077 ENSRNOP00000000077 NP_001099494.1.100692 NP_001099494.1.4139 ENSRNOP00000000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]