SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000173 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000173
Domain Number 1 Region: 19-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-37
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000173   Gene: ENSRNOG00000024138   Transcript: ENSRNOT00000000173
Sequence length 189
Comment pep:known chromosome:Rnor_5.0:X:5742912:5743481:-1 gene:ENSRNOG00000024138 transcript:ENSRNOT00000000173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTASCILPSQAIQQDNIYGLSQITTSLFISNSAVANDKLTLSNNHITTIINASVEVVNT
FFEDIQYVHVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSAALCLAYL
MKYHTMTLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFKLFSRNTVHMIYSPMGLIPNIYE
KDAYLMELM
Download sequence
Identical sequences D3ZAQ8
ENSRNOP00000000173 NP_001100441.1.100692 NP_001100441.1.4139 ENSRNOP00000000173 10116.ENSRNOP00000000173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]