SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000200 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000200
Domain Number 1 Region: 557-770
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.56e-75
Family Eukaryotic proteases 0.0000607
Further Details:      
 
Domain Number 2 Region: 335-451
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000445
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 3 Region: 87-171
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000248
Family SEA domain 0.0067
Further Details:      
 
Domain Number 4 Region: 219-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000157
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 5 Region: 530-569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 494-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 459-492
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000200   Gene: ENSRNOG00000000184   Transcript: ENSRNOT00000000200
Sequence length 772
Comment pep:known chromosome:Rnor_5.0:7:119649832:119680257:-1 gene:ENSRNOG00000000184 transcript:ENSRNOT00000000200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRCFQLPCSTRMPTAEVPQAAGGQGDGGDGEEAAEPEGVFKAPRNAKRKDRDYVRFTPL
LLVLAALASAGVMLWYFLGYKAEVTISQVYSGSLRVLNRHFSQDLARRESIAFRTETAKA
QKMFQELVASTRLGTYYNSSSIYAFGEGPLICFFWFILDIPEYQRLTLSPEVVRELLVGE
LLSNSSALASYRTEYEVDPEGLVILEASVNDIVVLNSTLGCYRYSYVNPGQVLRLRGPDQ
QTTSCLWHLQGPEDLMLKVQLEWTRVDCRDRVAMYDAAGPLEKRLITSVYGCSRQEPVME
VLASGSVMAVVWKKGLHSFYDPFLLSVKSVAFQDCQVNLTLEGRLDPQGFLRTPYYPSYY
SPSTHCSWHLTVPSLDYGLALWFDAYALRRQKYNLLCTQGQWMIQNRRLCGFRTLQPYAE
RIPVVASDGITINFTSQISLTGPGVQVYYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDC
PNGLDERNCVCRAMFQCQEDSTCISLPRVCDRQPDCLNGSDEEQCQEGVPCGTFTFQCED
RSCVKKPNPECDGQADCRDGSDEEHCDCGLQGPSSRIVGGAMSSEGEWPWQASLQIRGRH
ICGGALIADRWVITAAHCFQEDSMASPRLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYH
EEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREGGPGSSTL
QKVDVQLIPQDLCNEAYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKEPR
Download sequence
Identical sequences D3ZF49
10116.ENSRNOP00000000200 NP_001124028.1.100692 NP_001124028.1.4139 ENSRNOP00000000200 ENSRNOP00000000200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]