SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000337 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000337
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-34
Family Calponin-homology domain, CH-domain 0.00044
Further Details:      
 
Domain Number 2 Region: 85-236,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 707-738
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000727
Family LIM domain 0.0014
Further Details:      
 
Domain Number 4 Region: 675-706
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000301
Family LIM domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000337   Gene: ENSRNOG00000000307   Transcript: ENSRNOT00000000337
Sequence length 1047
Comment pep:known chromosome:Rnor_5.0:20:47892301:47904250:1 gene:ENSRNOG00000000307 transcript:ENSRNOT00000000337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHDHFETFVQAQLCQDVLSSFQGLCRALGVESGGGLPQYHKIKAQLNYWSA
KSLWAKLDKRASQPAYQQGQACTNTKCLVVGAGPCGLRAAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGFT
FTGLQPPPKKGSGWRARIQPSPPAQLASYEFDVLISAGGGKFVPEGFTIREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDLPETDQLLGKANVVPEALQQFARAAADFATQGKLGKLEFAQDARGRPD
VAAFDFTSMMRSESSARIQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGTGPLELLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVQ
DLYDIMDKEHARKKSDETDARKTTTGSAGTEELLHWCQEQTAGFPGVSVTDFSSSWADGR
ALCALVHRLQPGLLEPSELQGMSALEATAWALRVAEYELGIIPVLSAQAVVAGSDPLGLI
AYLSHFHSAFKNTPHSSGLVSQPHGTPSAILFLGKLQRSLQRTRTKVEEETPCTEEPPVS
EPSVPPALPSEHEEAGAEDVCELCGKRLYILERFCVDGHFFHRGCFCCRTCEATLRPGGY
GQYPGDGYFYCLQHLPQEDQKEADNNGSPENQELPTPGDSTTQSGPSSPVPPVTEASPVP
SPSQPARRLIRLSSVERLRLSSLNIIPDSGVEPPPKPPRSCLDLAQESLKSSFMGWGVLR
APQVPEAIEKGEEEEEEEEEEEEEEEELPPPLALEVEQSLLTLAKNSGDMTKYPTWRRTL
MRRAKEEEMKRFCKAQAIQRRLNEIEAAMRELETEGMKLEVALRKESSSPEKQKKLWLEQ
LLQLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHEFRGINREETLKTQADRLSEDRVL
RKLLDVVNQRDALIQFQEERRLREMPV
Download sequence
Identical sequences D3ZBP4
ENSRNOP00000000337 10116.ENSRNOP00000000337 NP_001099867.1.100692 NP_001099867.1.4139 ENSRNOP00000000337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]