SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000661 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000661
Domain Number 1 Region: 81-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000661   Gene: ENSRNOG00000024413   Transcript: ENSRNOT00000000661
Sequence length 214
Comment pep:known chromosome:Rnor_5.0:20:33556854:33558331:1 gene:ENSRNOG00000024413 transcript:ENSRNOT00000000661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHPLDAPTIQVSQETQQPFPGASDHEVLSSNSTPPSPTLVPRDCSEAEAGDCRGTSRK
LRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSSGDWGSIYSPVSQAG
SLSPTASLEEFPGLQVPSSPSCLLPGTLVFSDFL
Download sequence
Identical sequences O08718
10116.ENSRNOP00000000661 ENSRNOP00000000661 ENSRNOP00000000661 NP_067732.1.100692 NP_067732.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]