SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000674 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000674
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.83e-108
Family Inorganic pyrophosphatase 0.000000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000674   Gene: ENSRNOG00000000558   Transcript: ENSRNOT00000000674
Sequence length 289
Comment pep:known chromosome:Rnor_5.0:20:33048101:33089923:1 gene:ENSRNOG00000000558 transcript:ENSRNOT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSSEERAAPFTLEYRVFIKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDEHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYHDISDVERLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKNKEFAVDIIKNTHDYWKALVTKKTDGKGI
SCMNTTVSESPFKCDPDAAKAIVDALPPPCESACALPMDVDKWFHHQKN
Download sequence
Identical sequences F7EPH4
NP_001094304.1.100692 NP_001094304.1.4139 ENSRNOP00000000674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]