SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001058 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001058
Domain Number 1 Region: 92-171
Classification Level Classification E-value
Superfamily Ribosomal protein S18 2.75e-24
Family Ribosomal protein S18 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001058   Gene: ENSRNOG00000000804   Transcript: ENSRNOT00000001058
Sequence length 257
Comment pep:known chromosome:Rnor_5.0:20:5442393:5448452:1 gene:ENSRNOG00000000804 transcript:ENSRNOT00000001058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDKMAASLRHTLLRLYPSLLRSSYVAQVPLQTLCTRSPPEDASSSLPVSPFENEPWKYL
DSEEYQNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRKDKVAGNPCPICRDHKLHVDFRN
VKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKAREYGLLSYYVPQVEPRDADLRT
VHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEASGPPPESMPEMP
STAPAEASTEQTGSQSA
Download sequence
Identical sequences F6Q5K7
ENSRNOP00000001058 NP_997699.2.100692 NP_997699.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]