SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001403 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001403
Domain Number 1 Region: 123-191
Classification Level Classification E-value
Superfamily RILP dimerisation region 5.1e-18
Family RILP dimerisation region 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000001403
Domain Number - Region: 69-93
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0615
Family Mitotic arrest deficient-like 1, Mad1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001403   Gene: ENSRNOG00000001061   Transcript: ENSRNOT00000001403
Sequence length 197
Comment pep:known chromosome:Rnor_5.0:12:39415025:39426666:1 gene:ENSRNOG00000001061 transcript:ENSRNOT00000001403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVREEEDGEEDEGALAKSPLQLTTEDVYDISYVVGRELMALGSDPRVTRLQFKIVR
VMEMLEALVNEGSLAVEELRMERDNLKQEVEGLRRAGVSGSEVNLGPDKMVVDLTDPNRP
RFTLQELRDVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAMVTMGNGEKE
ERTIMKKLFSFRSGKHT
Download sequence
Identical sequences Q6AYA0
NP_001004205.1.100692 NP_001004205.1.4139 ENSRNOP00000001403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]