SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001625 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001625
Domain Number 1 Region: 340-746
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.68e-111
Family Phosphofructokinase 0.0000106
Further Details:      
 
Domain Number 2 Region: 8-341
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.96e-105
Family Phosphofructokinase 0.000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001625   Gene: ENSRNOG00000001214   Transcript: ENSRNOT00000001625
Sequence length 780
Comment pep:known chromosome:Rnor_5.0:20:13563769:13585934:1 gene:ENSRNOG00000001214 transcript:ENSRNOT00000001625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
AMDEKRFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
SVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
Download sequence
Identical sequences P30835
ENSRNOP00000001625 10116.ENSRNOP00000001625 ENSRNOP00000001625 NP_037322.1.100692 NP_037322.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]