SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001668 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000001668
Domain Number - Region: 8-30
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000251
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001668   Gene: ENSRNOG00000001243   Transcript: ENSRNOT00000001668
Sequence length 476
Comment pep:known chromosome:Rnor_5.0:12:40191351:40200212:1 gene:ENSRNOG00000001243 transcript:ENSRNOT00000001668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVKAKRPKPHCFNCGSEEHQMKECPMPRNAARISEKRKEYMDACGEANSQSFQQRYHAE
EVEERFGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELETSGLALYD
GNDDADGETETGEIQNKNVTYDLSKLVNYPGFNISTPRGIPDEWRMFGSIPMQACQQKDV
FASYLNSNIQSPSVKSSSKRSSSQSSPNSPKKQRREGSAAASPADMELDSDIEIPPGSQS
SKAFQFQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDEDALTL
EELEEQQRQIWAALQQAEGANSDSDVPMDTPLTGNSVASSPCPNEFDLRVPEGRALEKPV
LAEPDTASPEPSCSPAAEAAVLSQKEEGVSAEGDPGDGLLDNGGVLNISNGGNHLDTRPP
TASKTHSPVPDMSKFAHGITPFEFENMAESTGMYLRIRNLLKNSPRNQQKNKKTSE
Download sequence
Identical sequences NP_001099399.1.100692 NP_001099399.1.4139 ENSRNOP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]