SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001887 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001887
Domain Number 1 Region: 158-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-35
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 36-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-35
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 337-462
Classification Level Classification E-value
Superfamily TIMP-like 1.41e-32
Family Netrin-like domain (NTR/C345C module) 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001887   Gene: ENSRNOG00000025001   Transcript: ENSRNOT00000001894
Sequence length 468
Comment pep:known chromosome:Rnor_5.0:12:24171335:24177682:1 gene:ENSRNOG00000025001 transcript:ENSRNOT00000001894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAALTSLLGPFLLAWVLPLARGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNK
KCIWTITVPEGQTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVV
APGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRMEKAQGTLTTPNWPESDYP
PGISCSWHIIAPSNQVIMLTFGKFDVEPDTYCRYDSVSVFNGAVSDDSKRLGKFCGDKAP
SPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESAPSPGEDAQHGPQSRSDPK
TGTGPKVKPPSKPKVQPVEKPEGSPATQATPVAPDAPSITCPKQYKRSGTLQSNFCSSSL
VVTGTVKAMVRGPGEGLTVTVSLLGVYKTGDLDLPSPASGTSLKFYVPCKQMPPMKKGAS
YLLMGQVEENRGPILPPESFVVLYRPNQDQILSNLSKRKCPSQPRPDA
Download sequence
Identical sequences O08628
NP_062110.1.100692 NP_062110.1.4139 ENSRNOP00000001887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]