SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002251 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002251
Domain Number 1 Region: 269-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000257
Further Details:      
 
Domain Number 2 Region: 56-165
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-30
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 3 Region: 169-266
Classification Level Classification E-value
Superfamily LCCL domain 2.62e-23
Family LCCL domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002251   Gene: ENSRNOG00000001651   Transcript: ENSRNOT00000002251
Sequence length 751
Comment pep:known chromosome:Rnor_5.0:11:47430604:47483838:-1 gene:ENSRNOG00000001651 transcript:ENSRNOT00000002251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XATGRAPLPSAGWCPLPPGRNSSSRPRLLLLLLLLLLLLPDAGAQKGDGCGHTVLGPESG
TLTSINYPHTYPNSTVCKWEIRVKTGERIRIKFGDFDIEDSDYCHLNYLKIFNGIGVSRT
EIGKYCGLGLQMNQSIESKGSEITVLFMSGIHASGRGFLASYSVIDKQDLITCLDTVSNF
LEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGIHAGVVSDVLGGQISVVISKGT
PYYESSLANNVTSMVGYLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHMGQ
ENSWKPEKARLRKPGPPWAAFATDEHQWLQIDLNNKEKKITGIVTTGSTLIEHNYYVSAY
RVLYSDDGQKWTVYREPGAAQDKIFQGNKDYHKDVRNNFLPPIIARFIRVNPVQWQQKIA
MKVELLGCQFTLKGRLPKLTQPPPPRNSNNLKNTTVHPKLGRAPKFTQALQPRSRNDLPL
LPAQTTATPDVKNTTVTPSVTKDVALAAVLVPVLVMALTTLILILVCAWHWRNRKKKAEG
TYDLPHWDRAGWWKGVKQLLPAKSVEHEETPVRYSNSEVSHLSPREVTTVLQADSAEYAQ
PLVGGIVGTLHQRSTFKPEEGKEASYADLDPYNAPVQEVYHAYAEPLPVTGPEYATPIVM
DMSGHSTASVGLPSTSTFRTAGNQPPALVGTYNTLLSRTDSCSSGQAQYDTPKGGKPAAA
PEELVYQVPQSTQEASGAGRDEKFDAFKETL
Download sequence
Identical sequences ENSRNOP00000002251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]