SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002512 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002512
Domain Number 1 Region: 406-721
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-77
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 29-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.0000154
Further Details:      
 
Domain Number 3 Region: 189-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-33
Family Spermadhesin, CUB domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 305-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 139-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002512   Gene: ENSRNOG00000001827   Transcript: ENSRNOT00000002512
Sequence length 733
Comment pep:known chromosome:Rnor_5.0:11:79949379:79998571:-1 gene:ENSRNOG00000001827 transcript:ENSRNOT00000002512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLSFRRLLLYHVLCLTLTEVSAHTVELNEMFGQIQSPGYPDSYPSDSEVTWNITVPEG
FRVQLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMS
VTFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILH
TDNRTCRVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIE
DHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYR
AAGNECPKLQPPVYGKIEPSQAVYSFKDQVLISCDTGYKVLKDNEVMDTFQIECLKDGAW
SNKIPTCKIVDCGVPAVLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCS
AHGTWTNEVLKRSLPTCLPVCGQPSRALPNLVKRIIGGRNAELGLFPWQALIVVEDTSRI
PNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKDHVTVYLGLHDVRDKSGAVNSS
AARVVLHPDFNIQNYNHDIALVQLQEPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGI
SNPNVTVDEIIISGTRTLSDVLQYVKLPVVSHAECKASYESRSGNYSVTENMFCAGYYEG
GKDTCLGDSGGAFVIFDEMSQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLLEEM
NSPRGVRELQVER
Download sequence
Identical sequences 10116.ENSRNOP00000002512 XP_006248588.1.100692 ENSRNOP00000002512 ENSRNOP00000002512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]