SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002962 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002962
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 8.11e-26
Family Ribosomal protein S18 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002962   Gene: ENSRNOG00000002178   Transcript: ENSRNOT00000002962
Sequence length 143
Comment pep:known chromosome:Rnor_5.0:14:10388657:10394875:-1 gene:ENSRNOG00000002178 transcript:ENSRNOT00000002962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLLALRSCIGRKNLTTATGCFTDRATHAVSVPWRRCFSQYEQVTSNEDLPIPMENPYK
EPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEVTKAIKRAQKMGF
MPVTYKDPAYLKDPKVCNIRYRE
Download sequence
Identical sequences D4A4V1
NP_001099466.1.100692 NP_001099466.1.4139 ENSRNOP00000002962 10116.ENSRNOP00000002962 ENSRNOP00000002962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]