SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003413 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003413
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.22e-41
Family G proteins 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003413   Gene: ENSRNOG00000002440   Transcript: ENSRNOT00000003413
Sequence length 173
Comment pep:known chromosome:Rnor_5.0:13:40612012:40621240:-1 gene:ENSRNOG00000002440 transcript:ENSRNOT00000003413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLWDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVF
SITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARGKAEEWGVQ
YVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGRKSGKSKKSFKERCCLL
Download sequence
Identical sequences ENSRNOP00000003413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]