SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003759 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003759
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-28
Family C-type lectin domain 0.00000245
Further Details:      
 
Domain Number 2 Region: 261-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 199-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 502-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 315-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 378-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000117
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 634-699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 579-644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 10 Region: 159-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003759   Gene: ENSRNOG00000002794   Transcript: ENSRNOT00000003759
Sequence length 767
Comment pep:known chromosome:Rnor_5.0:13:87318111:87344163:1 gene:ENSRNOG00000002794 transcript:ENSRNOT00000003759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGCPKGSWKPRLRSVVLGAAQLVWLSALISELVNQKEVAAWTYNYSTKAYSWNNSRAFCK
RHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNE
PNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGECIETIGSY
TCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSE
MQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGS
DILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLM
GNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGTLKYQSACSFSCDEGSL
LVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEG
FYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCN
EEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFG
PNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGN
FSYGSTCAFHCPEGQSLNGSARTTCREDGHWSDAMPTCQAGTLTIQEALTYLGGALASTT
GLAVGGTLLALLRKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP
Download sequence
Identical sequences F1LNV1
10116.ENSRNOP00000003759 ENSRNOP00000003759 ENSRNOP00000003759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]