SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003784 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003784
Domain Number 1 Region: 427-562
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-31
Family Netrin-like domain (NTR/C345C module) 0.028
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-20
Family I set domains 0.053
Further Details:      
 
Domain Number 3 Region: 380-432
Classification Level Classification E-value
Superfamily BPTI-like 7.09e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 4 Region: 319-375
Classification Level Classification E-value
Superfamily BPTI-like 7.52e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 5 Region: 118-168
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000126
Family Ovomucoid domain III-like 0.032
Further Details:      
 
Domain Number 6 Region: 32-83
Classification Level Classification E-value
Superfamily Elafin-like 0.000000131
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003784   Gene: ENSRNOG00000002831   Transcript: ENSRNOT00000003784
Sequence length 571
Comment pep:novel chromosome:Rnor_5.0:10:81770067:81775078:-1 gene:ENSRNOG00000002831 transcript:ENSRNOT00000003784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAPGHHRFWFHWGLLLLLLLGAPLRGLALPHIRYSHAGICPNDMNPNLWVDAQSTCKRE
CETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSECDI
WDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGVTLSVVTCRYHFTWPNTS
PPPPETTVHPTTASPETLGLDMAAPALLNHPVHQSVTVGETVSFLCDVVGRPRPELTWEK
QLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNVAGVLRADFPLSVV
RGGQARATSESSLNGTAFPATECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCHRNL
NHFETYEACMLACMSGPLATCSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNN
FESREACEESCPFPRGNQNCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTV
DEVLKDEKMGLKFLGREPLEVTLLHVDWTCPCPNVTVGETPLIIMGEVEGGMAMLKPDSF
VGASSTRRVRKLREVMYKKTCDVLKDFLGLQ
Download sequence
Identical sequences D3Z9K5
XP_017459617.1.4139 XP_220855.1.100692 NYSGRC-IgSF-ENSRNOP00000003784 ENSRNOP00000003784 10116.ENSRNOP00000003784 ENSRNOP00000003784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]