SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004196 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004196
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-81
Family Sec7 domain 0.00000000501
Further Details:      
 
Domain Number 2 Region: 260-380
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-35
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004196   Gene: ENSRNOG00000043381   Transcript: ENSRNOT00000004196
Sequence length 397
Comment pep:known chromosome:Rnor_5.0:10:106832874:106916333:-1 gene:ENSRNOG00000043381 transcript:ENSRNOT00000004196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPT
PEEKEDWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences B2GUV0 Q8K3E8
ENSRNOP00000004196 NP_001106169.1.92730 XP_006247846.1.100692 XP_021067356.1.100879 ENSMUSP00000017276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]