SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004559 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004559
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.91e-83
Family Eukaryotic proteases 0.0000000247
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 9.42e-26
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 126-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000475
Family EGF-type module 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004559   Gene: ENSRNOG00000003430   Transcript: ENSRNOT00000004559
Sequence length 462
Comment pep:known chromosome:Rnor_5.0:X:143127239:143171465:1 gene:ENSRNOG00000003430 transcript:ENSRNOT00000004559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAPGLIPIFLLGYLLSTECAVFLDRENATKILTRPKRYNSGKLEEFVQGNLERECIEE
RCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDDINSYECWCQAGFEGRN
CELDATCSIKNGRCKQFCKNSPDNKIICSCTEGYQLAEDQKSCEPAVPFPCGRVSVAYNS
KKITRAETVFSNTDYGNSTELILDDITNSTILDNLTENSEPINDFTRVVGGENAKPGQIP
WQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEHNIDEKEDTEQRRNVIRT
IPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFLKFGSGYVSGWGKV
FNKGRQASILQYLRVPLVDRATCLRSTKFSIYNNMFCAGYREGGKDSCEGDSGGPHVTEV
EGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences P16296
ENSRNOP00000004559 NP_113728.1.100692 NP_113728.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]