SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004599 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004599
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.1e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0048
Further Details:      
 
Domain Number 2 Region: 297-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004599   Gene: ENSRNOG00000003400   Transcript: ENSRNOT00000004599
Sequence length 560
Comment pep:known chromosome:Rnor_5.0:13:85580300:85598234:-1 gene:ENSRNOG00000003400 transcript:ENSRNOT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLSSIKCCLDENLEPTCFERSSDFGGLWKFAEASEDGMTRVYRSLVT
NVCKEMSCYSDFPFHEDYPNFMSHEKFWDYLREFAEHFGLLKYIRFKTTVRSVTKRPDFS
ETGQWEVVTETEGKQDRAVFDAVMVCTGQFLSPRLPLESFPGIHKFKGQILHSQEYRIPD
AFRGKRILVVGLGNTGGDVAVELSGIAAQVFLSTRTGAWVRSRSSVGGYPLNMMQTRWRN
FLAQVLPSRFVSWNQERQMNKIFNHENYGLSIAKGKKPKFIVNDELPTCILCGKITMKTS
VKDFTESSIVFEDGTIEANIDVVIFTTGYEFSFPFFEEPLKSLCTKKVILYKRVFPPNLE
RSTLAIIGLISLTGSILVGTEFQARWATRVFKGLCNIPPSQKLMAEAIKKEELIKRGVIK
DTSQDKLDFISYMDELTQCIGAKPNIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGRWDG
ARNAILTQWDRTVKPLKTRTVPKSQEPASLSRYLKTWGAPVLIVSLLLIYKSSLFLELVQ
SKLQGRFSPSRILWYIPQNS
Download sequence
Identical sequences Q8K4B7
ENSRNOP00000004577 10116.ENSRNOP00000004599 XP_006250206.1.100692 ENSRNOP00000004599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]