SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004896 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004896
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-46
Family FAD-linked reductases, N-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 311-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.04e-23
Family L-aminoacid/polyamine oxidase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004896   Gene: ENSRNOG00000003567   Transcript: ENSRNOT00000004896
Sequence length 477
Comment pep:known chromosome:Rnor_5.0:13:94276960:94281095:-1 gene:ENSRNOG00000003567 transcript:ENSRNOT00000004896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTVIVLGGGISGLAASYHLTRSPSPPKVILVEGSKRLGGWIRSVRGSDGAIFELGPRG
IRPAGALGARTLLLVSELGLESEVLPVRGDHPAAQNRFLYVGGALHPLPSGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSQELSI
RSCFPSLFQAEQTHGSMLLGLLLGAGQTPQPNSSLIRQARAERWSQWSLRGGLEMLPQAL
HNYLTSKGVTILSGQPACGLSLQPEGHWKVSLGDSSLEADHIISTIPASVLSKLLPAEAA
PLAHILSTIQAVSVAVVNLQYKGACLPVQGFGHLVPSSEDPTVLGIVYDSVAFPEQDGNP
PGLRLTVMLGGYWLQKLKANGHELSPELFQRAAQEAAATQLGLKEQPSHCLVHLHKNCIP
QYTLGHWQKLDSALQFLTAQRLPLTLAGASYEGVAVNDCIESGRQAAIAVLGTESNS
Download sequence
Identical sequences D3ZVN7
10116.ENSRNOP00000004896 ENSRNOP00000004896 ENSRNOP00000004896 NP_001099438.1.100692 NP_001099438.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]