SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005132 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000005132
Domain Number - Region: 114-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0238
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005132   Gene: ENSRNOG00000003822   Transcript: ENSRNOT00000005132
Sequence length 586
Comment pep:known chromosome:Rnor_5.0:10:28871472:28886424:1 gene:ENSRNOG00000003822 transcript:ENSRNOT00000005132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAVDPVSATPMTGSKEMNLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN
PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSITTKYRKGAC
ENCGAMTHKRKDCFERPRRVGAKFTGTNIAPDEHIQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDE
DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVK
KEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE
EDVKINNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKESVNSEECIINDATGEEPV
KKPQTLMELHQEKLKEEKKKKKKKKKHRKSSSDSDDDEERKQEKLKKALNAEEARLLHVK
EIMQVDERKRPYNSIYETREPTEEEMEAYRMKRQRPDDPMASFLGQ
Download sequence
Identical sequences B0BNL0 Q80ZG5
NP_001094020.1.100692 NP_001094020.1.4139 XP_008765864.1.100692 ENSRNOP00000005132 ENSRNOP00000005132 10116.ENSRNOP00000005132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]