SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005284 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005284
Domain Number 1 Region: 219-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-17
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 36-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000027
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 4 Region: 97-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000144
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005284   Gene: ENSRNOG00000003927   Transcript: ENSRNOT00000005284
Sequence length 399
Comment pep:known chromosome:Rnor_5.0:13:52179638:52206115:-1 gene:ENSRNOG00000003927 transcript:ENSRNOT00000005284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRTRAPGTRAPPPPPLLLSLSLLLLLLSPTVSGDCGPPPDIPNATPNSGKHTKFAHQSQ
VTYSCNKGFKQIPDKPNTVVCLENDQWSNYETFCNKTCSAPLRLNYASLKKEYRNMNFFP
IGTTVEFECRPGFQKVTSRTGKSTCLEELVWSPVVEFCKKRACPNPRELKNGHINIPTDI
LFGSEIIFSCDKGYKLVGVTSTFCSITGNAVDWDDVFPVCTTIFCPDPPKINNGRIREES
DSYAYRQSVTYSCDQGFILVGNSSVHCTLNGEVGEWSSAPPKCIERHKVPTKTPPEVDIP
STMPHESTLINFPSTRAPLSHKPTTVKVPGTRVKPTSHKPTEVKVPATQHVPVSKTTVRH
PTRTSKDRGESNSGGDHFIYGHTCLITMTILHVMLLLTG
Download sequence
Identical sequences Q9Z0M0
ENSRNOP00000005284 NP_071605.2.100692 NP_071605.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]