SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005461 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005461
Domain Number 1 Region: 119-191
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.23e-17
Family Complement control module/SCR domain 0.0002
Further Details:      
 
Domain Number 2 Region: 181-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.00037
Further Details:      
 
Domain Number 3 Region: 242-306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000157
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 4 Region: 433-494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000537
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 489-546
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 6 Region: 306-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000131
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 57-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000301
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 393-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000695
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005461   Gene: ENSRNOG00000004062   Transcript: ENSRNOT00000005461
Sequence length 601
Comment pep:known chromosome:Rnor_5.0:13:52430756:52466244:-1 gene:ENSRNOG00000004062 transcript:ENSRNOT00000005461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTKQHQALRPTRAAHGKLHRNRDAVAWPLSTFCRASGPTLFQMSLTAALWVAVFGKCGP
PPDLPYALPASEMNQTDFESHTTLRYNCRPGYSRASSSQSLYCKPLGKWQINIACVKKSC
RNPGDLQNGKVEVKTDFLFGSQIEFSCSEGYILIGSSTSYCEIQGKGVSWSDPLPECVIA
KCGMPPDISNGKHNGREEEFFTYRSSVTYKCDPDFTLLGNASITCTVVNKTVGVWSPSPP
TCERIICPWPKVLHGTINSGFKHTYKYKDSVRFVCQKGFVLRGSGVIHCEADGSWSPVPV
CELNSCTDIPDIPNAALITSPRPRKEDVYPVGTVLRYICRPGYEPATRQPMTVICQKDLS
WSMLRGCKEICCPVPDPKSVRVIQHEKAHPDNDCTYFFGDEVSYTCQNDIMLTATCKSDG
TWHPRTPSCHQSCDFPPAIAHGRYTKSSSYYVRTQVTYECEEGYRLVGEATISCWYSQWT
PAAPQCKALCRKPEIGNGVLSTNKDQYVETENVTIQCDSGFVMLGSQSITCSENGTWYPK
VPRCEQEVPKDCEHVFAGKKLMQCLPNSNDVKMALEVYKLTLEIKQLQLQIDKAKHVDRE
L
Download sequence
Identical sequences Q5M891
ENSRNOP00000005461 ENSRNOP00000005461 10116.ENSRNOP00000005461 NP_036648.2.100692 NP_036648.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]