SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005718 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005718
Domain Number 1 Region: 15-130
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-28
Family Kringle modules 0.00089
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-20
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005718   Gene: ENSRNOG00000004122   Transcript: ENSRNOT00000005718
Sequence length 468
Comment pep:known chromosome:Rnor_5.0:10:12896141:12900598:-1 gene:ENSRNOG00000004122 transcript:ENSRNOT00000005718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPDLQGLLLLFPLLLPPHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCL
FWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLA
RGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGP
DRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDASSGNLLRAFDGAHPPPPGPLHLRT
AALLLTFRSDARGHAQGFALTYRGLQDTVEDRASPEDSAETLAGNPDGANVSCSPKPGAA
QASIGGEADLQARVFSTVMAISVLLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGR
SWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL
Download sequence
Identical sequences D4ADS5
10116.ENSRNOP00000005718 NP_001099237.1.100692 NP_001099237.1.4139 XP_017452550.1.100692 XP_017452551.1.100692 ENSRNOP00000005718 ENSRNOP00000005718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]