SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005746 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005746
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily TIMP-like 1.41e-67
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005746   Gene: ENSRNOG00000004303   Transcript: ENSRNOT00000005746
Sequence length 211
Comment pep:known chromosome:Rnor_5.0:7:23694454:23744372:-1 gene:ENSRNOG00000004303 transcript:ENSRNOT00000005746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPWLGLVLLLSCWSLGHWGTEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNF
VERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSISNATDP
Download sequence
Identical sequences Q4V8L0
NP_037018.2.100692 NP_037018.2.4139 XP_006241224.1.100692 ENSRNOP00000005746 10116.ENSRNOP00000005746 ENSRNOP00000005746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]