SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006184 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006184
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 1.77e-39
Family Globins 0.000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006184   Gene: ENSRNOG00000004583   Transcript: ENSRNOT00000006184
Sequence length 154
Comment pep:known chromosome:Rnor_5.0:7:118094391:118101652:-1 gene:ENSRNOG00000004583 transcript:ENSRNOT00000006184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE
DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY
SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences A0A1K0FUB2 Q9QZ76
10116.ENSRNOP00000006184 ENSRNOP00000006184 ENSRNOP00000006184 NP_067599.1.100692 NP_067599.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]