SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006360 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006360
Domain Number 1 Region: 406-609
Classification Level Classification E-value
Superfamily vWA-like 5.98e-55
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 226-419
Classification Level Classification E-value
Superfamily vWA-like 4.31e-47
Family Integrin A (or I) domain 0.00044
Further Details:      
 
Domain Number 3 Region: 7-102
Classification Level Classification E-value
Superfamily LCCL domain 3.4e-30
Family LCCL domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006360   Gene: ENSRNOG00000004706   Transcript: ENSRNOT00000006360
Sequence length 616
Comment pep:novel chromosome:Rnor_5.0:6:1127877:1199126:1 gene:ENSRNOG00000004706 transcript:ENSRNOT00000006360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VECLLTVPQINCDVKAGKIINPEFLVKCPAGCQDPKYHVYGTGVYASYSSVCGAAVHSGV
LDDSGGKILVRKVAGQSFYKGSYSNGVQSLSLPRWRESFVVSESKPQKGVTYPSTLTYSS
PKTAAANAGETTKAYEKPSLPGTTAQPVTLSQALATPVAEATHRATSKPFAASVTSSSRP
QPVGHRSQEMEEMATWKPEPVLLDSGFVPKEELSTQSSEPVLQGDPNCKIDLSFLIDGST
GIGKRRFQIQKQFLVDVVQALDIGPGGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEK
ITQRGGLSNVGRAISFVTKNFFSKANGNRGGAPNVAVVLVDGGPTDKIEEVSRVARESGI
NVFFVTVEGAAEREKQHVVEPNFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVCDTD
RLACSKTCLNSADIGFVIDGSSSVGTSNFRTVLQFVANLSKEFEISDTDTRIGAVQYTYE
QRLEFGFDKYNSKADVLSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMILITD
GRSYDDVRIPAMAAYQKGVITYAIGIAWAAQDELEVIATHPARDHSFFVDEFDNLYKFVP
RIIRNICTEFNSQPRN
Download sequence
Identical sequences ENSRNOP00000006360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]