SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006526 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006526
Domain Number 1 Region: 140-722
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.77e-197
Family Myeloperoxidase-like 0.0000000000737
Further Details:      
 
Domain Number 2 Region: 730-790
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000917
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 781-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006526   Gene: ENSRNOG00000004646   Transcript: ENSRNOT00000006526
Sequence length 914
Comment pep:known chromosome:Rnor_5.0:6:57702554:57770914:-1 gene:ENSRNOG00000004646 transcript:ENSRNOT00000006526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLGAMAVMLVVMGTAIFLPFLLRSRDILGGKTMTSHVINVVETSQLLVDNAVYNTMKR
NLKKRGVLSPAQLLSFSKLPESTSGAISRAAEIMETSIQVMKREQSQFSTDALSADILAT
IANLSGCLPFMLPPRCPDTCLANKYRPITGVCNNRDHPRWGASNTALARWLPPVYEDGFS
QPRGWNPNFLYHGFPLPPVREVTRHLIQVSNEAVTEDDQYSDFLPVWGQYIDHDIALTPQ
STSTAAFWGGVDCQLTCENQNPCFPIQLPSNSSRTTACLPFYRSSAACGTGDQGALFGNL
SAANPRQQMNGLTSFLDASTVYGSSPGVEKQLRNWSSSAGLLRVNTLHLDSGRAYLPFAS
AACAPEPGAPHANRTPCFLAGDGRASEVPALAAVHTLWLREHNRLATAFKAINTHWSANT
AYQEARKVVGALHQIITMRDYIPKILGPDAFRQYVGPYEGYNPTVNPTVSNVFSTAAFRF
GHATVHPLVRRLNTDFQDHTELPRLQLHDVFFRPWRLIQEGGLDPIVRGLLARPAKLQVQ
EQLMNEELTERLFVLSNVGTLDLASLNLQRGRDHGLPGYNEWREFCGLSRLETPAELNKA
IANRSMVNKIMELYKHADNIDVWLGGLAEKFLPGARTGPLFACIIGKQMKALRDGDRFWW
ENSHVFTDAQRQELEKHSLPRVICDNTGLTRVPVDAFRIGKFPQDFESCEEIPSMDLRLW
RETFPQDDKCVFPEKVDNGNFVHCEESGKLVLVYSCFHGYKLQGQEQVTCTQNGWDSEPP
VCKDVNECADLTHPPCHSSAKCKNTKGSFQCVCTDPYVLGEDEKTCIDSGRLPRASWVSI
ALGALLIGGLASLSWTVICRWTHADKKSTLLITERVTTESGFRKSQESGISPQKAEVQDA
EQEPAYGSRVLLCE
Download sequence
Identical sequences F1LN48
NP_062226.2.100692 NP_062226.2.4139 ENSRNOP00000006526 ENSRNOP00000006526 10116.ENSRNOP00000006526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]