SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006946 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006946
Domain Number 1 Region: 445-469
Classification Level Classification E-value
Superfamily Notch domain 0.000068
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006946
Domain Number - Region: 946-1018
Classification Level Classification E-value
Superfamily EF-hand 0.00381
Family Penta-EF-hand proteins 0.074
Further Details:      
 
Domain Number - Region: 508-535
Classification Level Classification E-value
Superfamily Notch domain 0.00445
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006946   Gene: ENSRNOG00000005228   Transcript: ENSRNOT00000006946
Sequence length 1228
Comment pep:novel chromosome:Rnor_5.0:7:29063508:29128693:1 gene:ENSRNOG00000005228 transcript:ENSRNOT00000006946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREHMEEEQKAMREILGKNTTEPTK
KSERQLECLLTHCIKVPMLVLDPPLPANCTLKDLPALYPSFHAASDMFNIAKPKNPSTNV
SVVVFDTTKDVEDAHAGLFKGSSKQTVWRAYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
IQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKGFPELNKQTKKNMSISGKELAISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDIFQNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSAGSRYVAG
GGGTGNIGVGQRWQFGGGINTISYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYVVPKGEYLSYFSFANIAKRGVEGTYSDNPIVRHASIANKWKTIHL
IMHSGMNATTIYFNLTLQNSNDEEFKIQIAVEVDTREVPKPNSTTQKTYDNLVSPVTPLP
QADVPFEDVPKEKRFPRVRRPDVNATGKVQEEVKIPRVNISLLPKEAQVRLSNLDSQLER
GDITLKGYNLSKSALLRPFLRNSLDTKGKPQAGTDETKDNLEVPQEDPSHQRPRGFAAAR
RPERWTTPAETATVNGRDHGLNPPPTQPVPKENLSPLIIPPEGRMPKEGDRDRAEGNADS
HVPVNELVPGRRLQQHIPSYPGFLPWEKNKYFQDLLDEEESLKKQLAYFTDSRHAGRQLK
DTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHS
EDMQFAFSYFYYLMSAVQPLNLSQVFDEVDTDQSGVLSDREIRTLATRVHDLPLSLQDLT
GLEHMLINCSKLLPANITQLSNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDK
NKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVL
RDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIIFTVFSFF
AEQIIALKRKIFPRRRTHKEASPDQIRV
Download sequence
Identical sequences D3ZKE0
ENSRNOP00000006980 10116.ENSRNOP00000006946 ENSRNOP00000006946 XP_001079967.2.4139 XP_343195.3.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]