SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006980 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006980
Domain Number 1 Region: 338-362
Classification Level Classification E-value
Superfamily Notch domain 0.0000484
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006980
Domain Number - Region: 631-703
Classification Level Classification E-value
Superfamily EF-hand 0.00251
Family Penta-EF-hand proteins 0.074
Further Details:      
 
Domain Number - Region: 401-428
Classification Level Classification E-value
Superfamily Notch domain 0.00667
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006980   Gene: ENSRNOG00000005228   Transcript: ENSRNOT00000006980
Sequence length 913
Comment pep:novel chromosome:Rnor_5.0:7:29095091:29128693:1 gene:ENSRNOG00000005228 transcript:ENSRNOT00000006980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REILGKNTTEPTKKSERQLECLLTHCIKVPMLVLDPPLPANCTLKDLPALYPSFHAASDM
FNIAKPKNPSTNVSVVVFDTTKDVEDAHAGLFKGSSKQTVWRAYLTTDKEVPGLVLMQDL
AFLSGFPPTFKETIQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKGFPELNKQTKKN
MSISGKELAISPAYLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIF
IVTNGQIPSWLNLDNPRVTIVTHQDIFQNLSHLPTFSSPAIESHIHRIEGLSQKFIYLND
DVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGD
CSGNSAGSRYVAGGGGTGNIGVGQRWQFGGGINTISYCNQGCANSWLADKFCDQACNVLS
CGFDAGDCGQDHFHELYKVTLLPNQTHYVVPKGEYLSYFSFANTRRPERWTTPAETATVN
GRDHGLNPPPTQPVPKENLSPLIIPPEGRMPKEGDRDRAEGNADSHVPVNELVPGRRLQQ
HIPSYPGFLPWEKNKYFQDLLDEEESLKKQLAYFTDSRHAGRQLKDTFADSLRYVNKILN
SKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMS
AVQPLNLSQVFDEVDTDQSGVLSDREIRTLATRVHDLPLSLQDLTGLEHMLINCSKLLPA
NITQLSNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAF
KMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFE
LPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIIFTVFSFFAEQIIALKRKIFPRR
RTHKEASPDQIRV
Download sequence
Identical sequences ENSRNOP00000006980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]