SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007598 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007598
Domain Number 1 Region: 21-253
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-29
Family FAD-linked reductases, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007598   Gene: ENSRNOG00000005749   Transcript: ENSRNOT00000007598
Sequence length 665
Comment pep:known chromosome:Rnor_5.0:7:119167570:119179999:-1 gene:ENSRNOG00000005749 transcript:ENSRNOT00000007598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSGLLVALALHLAVCSRPHRDYCVLGAGPAGLQMAALLHRAGRDYEVFERESAPGSFF
TRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSDDPHLLFRHYSQAYFPDASDMVRYL
GDFAQRLGLRVLYNTNITHVTLDKDPQAWNGHYFILRDQKGQVYQCSVLLVATGLAVPKL
VDFPGSEYVEGYESVSVDPEDFVGQNVLILGHGNSAFETAENILGVTNFVHMLSRSRVRL
SWATHYVGDVRAINNGLLDTYQLKSLDGLLESDLEYLALVKDSKGKFHITLKFLLENSSN
QSADSIPLPQDDNDNFAMRVAYDRVIRCLGWKFDFSIFNQSLRLSSGTEFSKKYPLIKAS
YESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHGITWPSTQYPIT
QLTSSIIRRVNEASGLYQMFSVLADIILLKENATAFEYLEEFPIQMLAQLEMLTGRTARH
GIFVINMEYGKNFSGPEKDVFYYDRSVAHIEDAWMSNFLHPVIYYYRHLPTEQDMRFRPA
QWPLPRPVAIHHIVEDFLTDWTAPVGHILPLRRFLENCLDTDLRSFYAESCFLFTLTRQK
LPPFCQQGYLRMQGLSSTKSLRQHGVESRLLQDYTAMENSSRWLDDHSSAPGPLTQFLDS
NREEL
Download sequence
Identical sequences D4A1A1
ENSRNOP00000007598 NP_001178716.1.100692 NP_001178716.1.4139 XP_006241994.1.100692 XP_008763934.1.100692 ENSRNOP00000007598 10116.ENSRNOP00000007598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]