SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007640 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007640
Domain Number 1 Region: 82-289
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-44
Family Reprolysin-like 0.0045
Further Details:      
 
Domain Number 2 Region: 387-443
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000288
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 1072-1135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1298-1411
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000852
Family Spermadhesin, CUB domain 0.017
Further Details:      
 
Domain Number 5 Region: 742-809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 1024-1077
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 
Domain Number 7 Region: 1192-1277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000763
Family Spermadhesin, CUB domain 0.009
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000007640
Domain Number - Region: 690-747
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00144
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number - Region: 967-1017
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0183
Family TSP-1 type 1 repeat 0.009
Further Details:      
 
Domain Number - Region: 908-957
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.034
Family TSP-1 type 1 repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007640   Gene: ENSRNOG00000005780   Transcript: ENSRNOT00000007640
Sequence length 1425
Comment pep:known_by_projection chromosome:Rnor_5.0:3:10882195:10919906:1 gene:ENSRNOG00000005780 transcript:ENSRNOT00000007640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLCLWLPCQPFLAASIRGILTGAIFILGCWGLSDFQKSFLQDLEPKDLSSSFSRHTAP
LTGHPSSHLQRLRQRRTSEDILHLELLVAVGPDVYQAHQEDTERYVLTNLNIGSELLRNP
SLGAQLQVHLVKLIILSDSENTPNITTNITSSLMSVCEWSQTINPHDDRDPSHADLIIYI
TRFDLELPDGNQQVRGVTQQGGACSPSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGAP
GSGSTCEARGHVMASDGAVPAGGALEWSTCSQRQLQHLLSTGQMHCLWDPPGLQSGLTWH
QLVAQPGLFYSADDQCRVAFGAGAVACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLL
DGTECGVEKWCSKARCRSLAELAPVAVVHGHWSSWGPHSPCSRSCGGGVITRRRWCNNPR
PAFGGRACVGEDLQAKMCNTQACEKTQLEFMSEQCAQTDRHPLQLSQGSASFYHWDAAVQ
YSQGDTLCRHMCWAVGESFIVSRGDSFLDGTRCVPNGPREDGTVSLCLLGSCRTFGCDGK
MDSQQVWDACQVCGGDNSTCTSQNGSFTAGRAREYVTFLIVTPNMTSAHVINHRPLFTHL
AVRIQDHYIVSGKSSMSPNVTYPSLLEDYRVEYRVTLTEDQLPRLEEIHIRGPVRDDIEI
QVYRRYGGEYGGLTHPDITFTYFQRKQQAAWVWAAKRGPCSVSCGAGLRWVTYSCQDQAQ
NKWVRNAQCQGSPQPPAWQEPCVSAPCPPHWVADDFGPCSVSCGGGLRERSLRCVEAHNG
FLKTLPPAPCRAVAQQPAGEVENCNSQPCPTGWEVSDPSPCVSSACEPGLESGSGTCVPR
VGDSEKPAMAGPCRPDDMSPVPEPCVRTTCSPGSGPVDTMSLGEEASSPVGSGKPSSQAE
HVWTPLVGLCSISCGKGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARLCPAR
WETRVLAPCPVTCGGGRVPLAIHCVQLDHGRPVSVPHSKCWPAPRPGSFEDCSPEPCPAR
WKVLPLGPCSASCGLGTATQMVACVQLDQGHDNEVDETFCKALVRPPASVPCLIADCAYR
WHISTWTECSVSCGDGIQRRHGTCLGPQAQVPVPANFCQHLPKPVTVRGCWAGPCAGQKI
SSSLPHKEATLPSQTLAAVTAASLQWSQPQAQAHSLFPDSQSLGLQETLEEPGACGRQYL
EPTGTIDMRGQGQLDCVVAIGRPLGEVVTLQILESSLKCRAGELLLLWGKFTWRKMCWKM
SGRTFSTKANTVVVRQHRVLPGGGVLLLYRSQPAPGTFYKECDRQLFGPRGEITSPSLSP
DGRKAGTCRVFVSVAPQARIAIRALASDMGTASEGTSANYVSIRDIHGLKTTTFWGQQVL
YWESEGSEAELEFSHGFLEAHASFQGQYWTIPPRTPEQVNSVALS
Download sequence
Identical sequences ENSRNOP00000007640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]