SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007747 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007747
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 5.9e-55
Family C-type lysozyme 0.000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007747   Gene: ENSRNOG00000005825   Transcript: ENSRNOT00000007747
Sequence length 148
Comment pep:known chromosome:Rnor_5.0:7:60337951:60343246:-1 gene:ENSRNOG00000005825 transcript:ENSRNOT00000007747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLVLGFLLLSASVQAKTYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQA
RNYNPGDQSTDYGIFQINSRYWCNDGKTPRAKNACGIPCSALLQDDITQAIQCAKRVVRD
PQGIRAWVAWQRHCKNRDLSGYIRNCGV
Download sequence
Identical sequences F1M8E9
ENSRNOP00000007747 ENSRNOP00000059657 10116.ENSRNOP00000007747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]