SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009098 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009098
Domain Number 1 Region: 11-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000795
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009098   Gene: ENSRNOG00000006943   Transcript: ENSRNOT00000009098
Sequence length 173
Comment pep:known chromosome:Rnor_5.0:10:38445574:38455988:1 gene:ENSRNOG00000006943 transcript:ENSRNOT00000009098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPMHRLIARRQAEANKQHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE
NRLLQQSMGETNTERKTKKKRRPKSVTSTSSSDSSASESSSESETSASSSSEDSDADGSL
SSSSSSSAYSSSSSSSSSSSSSSSDSDSSSSSSSSSSSESSSDDEPPKKRKKK
Download sequence
Identical sequences Q5EB97
ENSRNOP00000009098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]