SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009139 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009139
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-90
Family Eukaryotic proteases 0.0000000284
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-28
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 3 Region: 214-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 88-168
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000222
Family SEA domain 0.012
Further Details:      
 
Domain Number 5 Region: 488-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 524-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009139   Gene: ENSRNOG00000005903   Transcript: ENSRNOT00000009139
Sequence length 855
Comment pep:known chromosome:Rnor_5.0:8:32266159:32305925:-1 gene:ENSRNOG00000005903 transcript:ENSRNOT00000009139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNNRGRKAGGGSQDFGAGLKYNSRLENMNGFEEGVEFLPVNNAKQVEKRGPRRWVVMVA
VVFSFLLLSLMAGLLVWHFHYRNVRIQKVFNGHLRITNENFLDAYENSTSTEFISLASQV
KEALKLMYSEVPVLGPYHKKSTVTAFSEGSVIAYYWSEFSIPPHLEEEVDRAMAVERVVT
LPPRARALKSFVLTSVVAFPIDPRMLQRTQDNSCSFALHARGRTVTRFTTPGFPNSPYPA
HARCQWVLRGDADSVLSLTFRSFDVAPCDGHDSDLVTVYDSLSPMEPHAVVRLCGTFSPS
YNLTFLSSQNVFLVTLITNTDRRHPGFEATFFQLPKMSSCGGLLSEAQGTFSSPYYPGHY
PPNINCTWNIKVPNNRNVKVRFKLFYLVDPNIPVGSCTKDYVEINGEKFCGERSQFVVSS
NSSKITVHFHSDHSYTDTGFLAEYLSYDSNDPCPGMFMCKTGRCIRKDLRCDGWADCPDY
SDERHCRCNATHQFMCKNQFCKPLFWVCDSVNDCGDGSDEEGCSCPAGSFKCSNGKCLPQ
SQQCNGKDDCGDGSDEASCDNVNAVSCTKYTYRCQNGLCLNKGNPECDGKKDCSDGSDEK
NCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQD
ETIFKYSDHTMWTAFLGLLDQSKRSASGVQEHKLKRIITHPSFNDFTFDYDIALLELEKP
AEYSTVVRPICLPDNTHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEELL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEKDGRIFQAGVVSWGEGCAQRNKPGVYT
RIPEVRDWIKEQTGV
Download sequence
Identical sequences Q9JJI7
NP_446087.1.100692 NP_446087.1.4139 ENSRNOP00000009139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]