SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009171 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009171
Domain Number 1 Region: 36-162
Classification Level Classification E-value
Superfamily Lysozyme-like 1.69e-46
Family C-type lysozyme 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009171   Gene: ENSRNOG00000006994   Transcript: ENSRNOT00000009172
Sequence length 163
Comment pep:known chromosome:Rnor_5.0:10:67900142:67903343:1 gene:ENSRNOG00000006994 transcript:ENSRNOT00000009172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARSRAPRRQPCPPGITWLALAYLLSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYNL
ADWICLAYYTSGFNTDAVDHEADGSTNNGIFQISSRKWCKNLAPNGPNLCRIYCTDLLSN
DLKDSVACVMKIAQEPQGLGYWESWKHHCQGRDLSDWVDGCDF
Download sequence
Identical sequences F1M6E7
ENSRNOP00000009171 NP_001099290.1.100692 NP_001099290.1.4139 XP_006247045.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]