SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009261 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009261
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily PH domain-like 8.16e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000735
Further Details:      
 
Domain Number 2 Region: 204-300
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.94e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 378-489
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.92e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009261   Gene: ENSRNOG00000006975   Transcript: ENSRNOT00000009261
Sequence length 501
Comment pep:known chromosome:Rnor_5.0:4:51455978:51504468:-1 gene:ENSRNOG00000006975 transcript:ENSRNOT00000009261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSG
VACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFAN
EEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYGSQVNNIS
HTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISE
AQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPP
ARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPP
LSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQ
NSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHS
SDEDEDDDDEEDFEDDDEWED
Download sequence
Identical sequences F1LSG0
NP_001103835.1.100692 NP_001103835.1.4139 ENSRNOP00000009261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]