SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009742 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009742
Domain Number 1 Region: 523-553,660-737
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000565
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009742   Gene: ENSRNOG00000029514   Transcript: ENSRNOT00000009742
Sequence length 790
Comment pep:known chromosome:Rnor_5.0:13:53585166:53611625:1 gene:ENSRNOG00000029514 transcript:ENSRNOT00000009742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRPRYVVDRAAYSLSLFDDEFEKKDRAYPVGEKLRNTFRCSSAKLKAIVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFQIFNATTNETYVDTVAMEAERLHVSATLACLT
AVIQMALGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFT
FIDICKNLPHTNIASLVFALVSGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
CKMPKKYHMQIVGEIRHGFPIPVAPMVSQWKDMVGTAFSLAIVGYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSILVVIFQTQFRNGSTLAQVMDTDIYVNPKTYNRVQEIEGVKIVTYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLRKQEKRMAVPTQQRKSLFMKTKTVSLQELQQ
DFESAASTDPNNNQAPVADAHISYITFSPDSSATAASELPTSTQSPREASDALASVPPFV
TFHTLILDMSGVSFVDLMGIKALAKLSSTYEKIGVQIFLVNIHAQVYNDISQGGIFEDGC
VQRNHVFPSIHDAVLFAQANAREAPAHNFQGAPGDTEFSLYDSEEDGSSYWDLEQEMFGT
MFHTETLTAL
Download sequence
Identical sequences D3ZV32
NP_001100642.1.100692 NP_001100642.1.4139 10116.ENSRNOP00000009742 ENSRNOP00000009742 ENSRNOP00000009742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]